CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TPHA_0E01290 *(Tetrapisispora phaffii)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	TPHA_0E01290	T385038_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RSC3 M00082_2.00	Saccharomyces cerevisiae	GCGCGCGG	CCGCGCGC	PBM Badis et al.(2008) RSC3_2035	0.601	0.789
RSC3 M01576_2.00	Saccharomyces cerevisiae	NNNNNSCGNN	NNCGSNNNNN	PBM Zhu et al.(2009) Rsc3	0.601	0.789
RSC3 M07509_2.00	Saccharomyces cerevisiae	NNVCGCG	CGCGBNN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0374.1	0.601	0.789
RSC3 M08655_2.00	Saccharomyces cerevisiae	NNVCGCG	CGCGBNN	Misc DeBoer et al.(2011) YDR303C_580	0.601	0.789
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCE63224	Zinc cluster	12	50	PACVQCRRRKIGCDRVKPVCGNCNKSGKYDCFFPDVPGM

Links
Other Zinc cluster family TFs
Other *Tetrapisispora phaffii* TFs