CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ORGLA09G0105800 *(Oryza glaberrima)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ORGLA09G0105800	T042977_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
fgenesh1_pg.scaffold_37000071 M01757_2.00	Physcomitrella patens	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8584	0.885	0.882
BIM1 M01710_2.00	Arabidopsis thaliana	NCRCGTGNNN	NNNCACGYGN	PBM Weirauch et al.(2014) pTH8114	0.855	0.882
BIM1 M06739_2.00	Arabidopsis thaliana	CACGTGAYNHNNNH	DNNNDNRTCACGTG	Dap-seq OMalley et al.(2016) BIM1_col_a	0.855	0.882
BIM1 M06740_2.00	Arabidopsis thaliana	NVKCACGTGMYHHNHNHNHNNN	NNNDNDNDNDDRKCACGTGMBN	Dap-seq OMalley et al.(2016) BIM1_colamp_a	0.855	0.882
BIM1 M09787_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BIM1_01	0.855	0.882
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ORGLA09G0105800.1	bHLH	220	270	PRSKHSATEQRRRSKINDRFQILRELLPHSDQKRDKATFLLEVIEYIRFLQ

Links
Other bHLH family TFs
Other *Oryza glaberrima* TFs