CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Thhalv10007196m.g *(Eutrema salsugineum)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02365 (NAM)	IPR003441	Thhalv10007196m.g	T299218_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NAC017 M07174_2.00	Arabidopsis thaliana	NCKTGNBNNNCAMGNWA	TWNCKTGNNNVNCAMGN	Dap-seq OMalley et al.(2016) ANAC017_colamp_v31	0.940	0.868
NAC017 M07175_2.00	Arabidopsis thaliana	NDNTTNCTTGBNNNNCAMG	CKTGNNNNVCAAGNAANHN	Dap-seq OMalley et al.(2016) ANAC017_col	0.940	0.868
NAC017 M11078_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AT1G34190_Q2	0.940	0.868
anac016 M07172_2.00	Arabidopsis thaliana	DVCKTGNBNNNCAMG	CKTGNNNVNCAMGBH	Dap-seq OMalley et al.(2016) ANAC016_col_a	0.933	0.930
anac016 M07173_2.00	Arabidopsis thaliana	TVCKTGNBNNNCAMG	CKTGNNNVNCAMGBA	Dap-seq OMalley et al.(2016) ANAC016_colamp_a	0.933	0.930
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10007196m	NAC/NAM	18	144	APGFRFHPTDEELVVYYLKRKVCGRKLRINAIGVVDVYKVDPSELPGLSVLKSGDRQWFYFTPRSRKYPNAARSSRGTATGYWKATGKDRVIVYNSRPVGLKKTLVFYRGRAPNGERTDWVMHEYTM

Links
Other NAC/NAM family TFs
Other *Eutrema salsugineum* TFs