TF Information

SPL6 *(Arabidopsis thaliana)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03110 (SBP)	IPR004333	AT1G69170	T322391_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Similar to a putative transcription factor and transcriptional coactivators. Repressor of GA responses and involved in gibberellic acid mediated signaling. Member of the DELLA proteins that restrain the cell proliferation and expansion that drives plant growth. The protein undergoes degradation in response to GA via the 26S proteasome. GAI may be involved in reducing ROS accumulation in response to stress by up-regulating the transcription of superoxide dismutases. Represses GA-induced vegetative growth and floral initiation. Rapidly degraded in response to GA.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
estExt_fgenesh1_pg.C_1940033 M02479_2.00	Physcomitrella patens	NNGTACGDH	DHCGTACNN	PBM Weirauch et al.(2014) pTH8664	0.899	0.773
SPL5 M02474_2.00	Arabidopsis thaliana	NNGTACGDN	NHCGTACNN	PBM Weirauch et al.(2014) pTH7385	0.888	0.667
SPL5 M07261_2.00	Arabidopsis thaliana	NDNYGTACGGAH	DTCCGTACRNHN	Dap-seq OMalley et al.(2016) SPL5_col_a	0.888	0.667
SPL5 M07262_2.00	Arabidopsis thaliana	NBGTACGGWH	DWCCGTACVN	Dap-seq OMalley et al.(2016) SPL5_colamp_a	0.888	0.667
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT1G69170.1	SBP	124	198	CQVYGCSKDLSSSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCSRFHFLSEFDDGKRSCRRRLAGHNERRRKP

Links
Other SBP family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

271 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action