CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pm003634 *(Prunus mume)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Pm003634	T006554_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB2G M06662_2.00	Arabidopsis thaliana	DCCRCCGCYDYHDYH	DRHDRHRGCGGYGGH	Dap-seq OMalley et al.(2016) At5g18450_col_a	0.750	0.878
DREB2D M01611_2.00	Arabidopsis thaliana	NNRCCGHNN	NNDCGGYNN	PBM Weirauch et al.(2014) pTH8108	0.734	0.857
DREB2D M06597_2.00	Arabidopsis thaliana	YHNYYDCCRCCGYYD	HRRCGGYGGHRRNDR	Dap-seq OMalley et al.(2016) At1g75490_col_a	0.734	0.857
DREB2D M06598_2.00	Arabidopsis thaliana	HNNHDYCACCGHYWN	NWRDCGGTGRHDNND	Dap-seq OMalley et al.(2016) At1g75490_colamp_a	0.734	0.857
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.728	0.857
PK08602.1 M01098_2.00	Cannabis sativa	NYCACCGCYN	NRGCGGTGRN	PBM Lambert et al.(2019) pTH11421	0.697	0.776
DREB2F M06630_2.00	Arabidopsis thaliana	YCDCCRCCGCY	RGCGGYGGHGR	Dap-seq OMalley et al.(2016) AT3G57600_col_a	0.679	0.796
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pm003634	AP2	88	139	CNFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYDEAARKLYGT

Links
Other AP2 family TFs
Other *Prunus mume* TFs