CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ONIVA06G31120 *(Oryza nivara)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	ONIVA06G31120	T276337_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK08316.1 M02350_2.00	Cannabis sativa	NNNRWATCNN	NNGATWYNNN	PBM Weirauch et al.(2014) pTH9488	0.849	0.891
RVE7 M01069_2.00	Arabidopsis thaliana	NDHRWATCNN	NNGATWYDHN	PBM Sullivan et al.(2014) pTH7081	0.823	0.913
RVE7 M02286_2.00	Arabidopsis thaliana	NDARTATCH	DGATAYTHN	PBM Weirauch et al.(2014) pTH7277	0.823	0.913
RVE7L M07071_2.00	Arabidopsis thaliana	NNNNWAAATATCWNN	NNWGATATTTWNNNN	Dap-seq OMalley et al.(2016) AT3G10113_col_a	0.823	0.913
RVE7 M07008_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) EPR1_colamp_a	0.823	0.913
RVE7 M07009_2.00	Arabidopsis thaliana	NWAAATATCTHN	NDAGATATTTWN	Dap-seq OMalley et al.(2016) EPR1_col	0.823	0.913
RVE1 M00879_2.00	Arabidopsis thaliana	AAATATCT	AGATATTT	PBM Franco-Zorrilla et al.(2014) RVE1	0.773	0.804
RVE1 M07128_2.00	Arabidopsis thaliana	NNNWAAATATCTNN	NNAGATATTTWNNN	Dap-seq OMalley et al.(2016) RVE1_col_a	0.773	0.804
RVE1 M07129_2.00	Arabidopsis thaliana	NNWAATATCW	WGATATTWNN	Dap-seq OMalley et al.(2016) RVE1_colamp_a	0.773	0.804
LHY M06997_2.00	Arabidopsis thaliana	NWAAATATCT	AGATATTTWN	Dap-seq OMalley et al.(2016) LHY1_col_a	0.772	0.804
LHY M06998_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LHY1_colamp_a	0.772	0.804
OS08G0157600 M02330_2.00	Oryza sativa	DNRTATCHN	NDGATAYNH	PBM Weirauch et al.(2014) pTH7793	0.763	0.804
CCA1 M00875_2.00	Arabidopsis thaliana	NDNRWATCN	NGATWYNHN	PBM Franco-Zorrilla et al.(2014) CCA1	0.717	0.761
CCA1 M11039_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CCA1_Q5	0.717	0.761
RVE6 M01081_2.00	Arabidopsis thaliana	AATATCTD	HAGATATT	PBM Sullivan et al.(2014) pTH7151	0.707	0.674
RVE6 M07138_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At5g52660_col_a	0.707	0.674
RVE6 M07139_2.00	Arabidopsis thaliana	NNNWAAATATCT	AGATATTTWNNN	Dap-seq OMalley et al.(2016) At5g52660_colamp_a	0.707	0.674
RVE5 M01079_2.00	Arabidopsis thaliana	NWAATATCHN	NDGATATTWN	PBM Sullivan et al.(2014) pTH7138	0.704	0.652
RVE5 M07100_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At4g01280_col_a	0.704	0.652
RVE5 M07101_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At4g01280_colamp_a	0.704	0.652
RVE8 M01074_2.00	Arabidopsis thaliana	NNNRWATCNN	NNGATWYNNN	PBM Sullivan et al.(2014) pTH7136	0.697	0.674
RVE8 M07069_2.00	Arabidopsis thaliana	NHNWAAATATCT	AGATATTTWNDN	Dap-seq OMalley et al.(2016) At3g09600_col_a	0.697	0.674
RVE8 M07070_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At3g09600_colamp_a	0.697	0.674
PK02532.1 M02347_2.00	Cannabis sativa	WAATATCTN	NAGATATTW	PBM Weirauch et al.(2014) pTH9579	0.697	0.652
RVE4 M07117_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LCL1_colamp_a	0.697	0.652
RVE4 M07118_2.00	Arabidopsis thaliana	NAAAATATCT	AGATATTTTN	Dap-seq OMalley et al.(2016) LCL1_col	0.697	0.652
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ONIVA06G31120.1	Myb	62	107	REKWTEEEHDKFLEALKLYGRSWRQIQEHIGTKTAVQIRSHAQKFF

Links
Other Myb/SANT family TFs
Other *Oryza nivara* TFs

478 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
AGL105	Arabidopsis thaliana	AT5G37415	I	0.000
AT5G26865	Arabidopsis thaliana	AT5G26865	N	0.000
AGL93	Arabidopsis thaliana	AT5G26950	N	0.000
AGL53	Arabidopsis thaliana	AT5G27070	N	0.000
AGL54	Arabidopsis thaliana	AT5G27090	N	0.000
AGL89	Arabidopsis thaliana	AT5G27580	N	0.000
AT5G27944	Arabidopsis thaliana	AT5G27944	N	0.000
fgenesh2_kg.6__2748__AT5G27944.1	Arabidopsis lyrata	fgenesh2_kg.6__2748__AT5G27944.1	N	0.000
fgenesh2_kg.6__2751__AT5G27070.1	Arabidopsis lyrata	fgenesh2_kg.6__2751__AT5G27070.1	N	0.000
scaffold_602835.1	Arabidopsis lyrata	scaffold_602835.1	N	0.000
Cagra.29077s0001	Capsella grandiflora	Cagra.29077s0001	N	0.000
Carubv10003642m.g	Capsella rubella	Carubv10003642m.g	N	0.000
Carubv10003716m.g	Capsella rubella	Carubv10003716m.g	N	0.000

ONIVA06G31120 (Oryza nivara) Myb/SANT

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

478 Related TFs

ONIVA06G31120 **(Oryza nivara)
Myb/SANT**