CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

DEHA2E10120g *(Debaryomyces hansenii)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	DEHA2E10120g	T366266_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LEU3 M01590_2.00	Saccharomyces cerevisiae	NNCGGNNNN	NNNNCCGNN	PBM Zhu et al.(2009) Leu3	0.560	0.650
LEU3 M07526_2.00	Saccharomyces cerevisiae	CCKDHDSCGS	SCGSHDHMGG	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0324.1	0.560	0.650
LEU3 M08684_2.00	Saccharomyces cerevisiae	SCKNNNNMGS	SCKNNNNMGS	Misc DeBoer et al.(2011) YLR451W_781	0.560	0.650
LEU3 M11482_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$LEU3_B	0.560	0.650
LEU3 M11483_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$LEU3_Q6	0.560	0.650
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAR65800	Zinc cluster	62	104	MACVECRQQKSRCDAHEKHPAPCSRCAKKGLQCNLKSDYKRTY

Links
Other Zinc cluster family TFs
Other *Debaryomyces hansenii* TFs