CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Thhalv10001792m.g *(Eutrema salsugineum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Thhalv10001792m.g	T009880_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF034 M06614_2.00	Arabidopsis thaliana	NHNYCACCGACANHD	HDNTGTCGGTGRNDN	Dap-seq OMalley et al.(2016) At2g44940_col_a	0.815	0.980
ERF034 M06615_2.00	Arabidopsis thaliana	NDBCACCGACANH	DNTGTCGGTGVHN	Dap-seq OMalley et al.(2016) At2g44940_colamp_a	0.815	0.980
ERF035 M06631_2.00	Arabidopsis thaliana	YCACCGACANWDNH	DNHWNTGTCGGTGR	Dap-seq OMalley et al.(2016) AT3G60490_col_a	0.797	0.940
ERF035 M06632_2.00	Arabidopsis thaliana	NNBCACCGACAHWNNN	NNNWDTGTCGGTGVNN	Dap-seq OMalley et al.(2016) AT3G60490_colamp_a	0.797	0.940
ERF043 M01627_2.00	Arabidopsis thaliana	YRCCGACA	TGTCGGYR	PBM Weirauch et al.(2014) pTH7413	0.783	0.880
ERF043 M06651_2.00	Arabidopsis thaliana	NNYCACCGACANHNNN	NNNDNTGTCGGTGRNN	Dap-seq OMalley et al.(2016) At4g32800_colamp_a	0.783	0.880
ERF043 M06652_2.00	Arabidopsis thaliana	NNYCACCGACANHNNH	DNNDNTGTCGGTGRNN	Dap-seq OMalley et al.(2016) At4g32800_col	0.783	0.880
Q8LKX0_MAIZE M09722_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DBF2_01	0.776	0.920
Q5MAR7_BRANA M09742_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBIII1_01	0.739	0.900
Q3HS44_BRANA M09741_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBIII2_01	0.739	0.900
Q3HS43_BRANA M09740_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBIII3_01	0.739	0.900
AT3G16280 M06618_2.00	Arabidopsis thaliana	NDNCACCGACANHN	NDNTGTCGGTGNHN	Dap-seq OMalley et al.(2016) AT3G16280_col_a	0.729	0.840
AT3G16280 M06619_2.00	Arabidopsis thaliana	BCACCGACAHWNNN	NNNWDTGTCGGTGV	Dap-seq OMalley et al.(2016) AT3G16280_colamp_a	0.729	0.840
ERF039 M01620_2.00	Arabidopsis thaliana	NNRCCGACDN	NHGTCGGYNN	PBM Weirauch et al.(2014) pTH8101	0.723	0.880
ERF039 M06635_2.00	Arabidopsis thaliana	HNNHDYCRCCGMCRN	NYGKCGGYGRHDNND	Dap-seq OMalley et al.(2016) At4g16750_col_a	0.723	0.880
ERF039 M06636_2.00	Arabidopsis thaliana	NNNNNNYCACCGACAHH	DDTGTCGGTGRNNNNNN	Dap-seq OMalley et al.(2016) At4g16750_colamp_a	0.723	0.880
ERF038 M06608_2.00	Arabidopsis thaliana	NHNHHDYCRCCGACA	TGTCGGYGRHDDNDN	Dap-seq OMalley et al.(2016) ERF38_col_a	0.723	0.860
ERF037 M00843_2.00	Arabidopsis thaliana	NRCCGACRN	NYGTCGGYN	PBM Franco-Zorrilla et al.(2014) At1g77200	0.710	0.860
ERF037 M06599_2.00	Arabidopsis thaliana	YCRCCGACAHHNNH	DNNDDTGTCGGYGR	Dap-seq OMalley et al.(2016) AT1G77200_col_a	0.710	0.860
ERF037 M06600_2.00	Arabidopsis thaliana	NNYACCGACAHN	NDTGTCGGTRNN	Dap-seq OMalley et al.(2016) AT1G77200_colamp_a	0.710	0.860
TINY M01094_2.00	Arabidopsis thaliana	NHRCCGACAN	NTGTCGGYDN	PBM Lambert et al.(2019) pTH11541	0.700	0.880
TINY M06669_2.00	Arabidopsis thaliana	HNYCRCCGACANHDN	NHDNTGTCGGYGRND	Dap-seq OMalley et al.(2016) TINY_col_a	0.700	0.880
Q3HS42_BRANA M09739_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBIII4_01	0.696	0.880
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10001792m	AP2	95	146	PTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGA

Links
Other AP2 family TFs
Other *Eutrema salsugineum* TFs

461 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
chr1.LjB17A22.10.nc	Lotus japonicus	chr1.LjB17A22.10.nc	N
chr1.LjB17A22.60.nc	Lotus japonicus	chr1.LjB17A22.60.nc	N
chr1.LjB17A22.80.nc	Lotus japonicus	chr1.LjB17A22.80.nc	N
LjSGA_056509.1	Lotus japonicus	LjSGA_056509.1	N
LjSGA_064645.1	Lotus japonicus	LjSGA_064645.1	N
LjSGA_074894.2	Lotus japonicus	LjSGA_074894.2	N
LjSGA_102731.1	Lotus japonicus	LjSGA_102731.1	N

Thhalv10001792m.g (Eutrema salsugineum) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

461 Related TFs

Thhalv10001792m.g **(Eutrema salsugineum)
AP2**