CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

CBG01251 *(Caenorhabditis briggsae)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00105 (zf-C4)	IPR001628	CBG01251	T301428_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CBG01250 M02391_2.00	Caenorhabditis briggsae	WBYGTGTC	GACACRVW	PBM Weirauch et al.(2014) pTH6110	0.776	0.629
nhr-182 M00701_2.00	Caenorhabditis elegans	DWBYGTGWCH	DGWCACRVWH	PBM Narasimhan et al.(2015) pTH10779	0.775	0.543
nhr-182 M00702_2.00	Caenorhabditis elegans	NNNHRTRNHN	NDNYAYDNNN	PBM Narasimhan et al.(2015) pTH6106	0.775	0.543
CBG23697_CONSTRUCT M01299_2.00	PBM CONSTRUCTS	NNTKTGTGTYN	NRACACAMANN	PBM Lambert et al.(2019) pTH11459	0.771	0.457
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CBG01251	Nuclear receptor	9	80	EPCKICHQPANGRHFGVMSCRACAAFFRRAASGNSKYLSVICTNANCIIFRNGKYKCKSCRLKKCHDVGMDP

Links
Other Nuclear receptor family TFs
Other *Caenorhabditis briggsae* TFs