CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Ogr03919 *(Ophisaurus gracilis)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Ogr03919	T047495_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MSGN1 M04144_2.00	Homo sapiens	NVMCAWWTGGYN	NRCCAWWTGKBN	SELEX Yin et al.(2017) MSGN1_eDBD_HT-SELEX	0.859	0.945
Msgn1 M08772_2.00	Mus musculus	NNRMCAAATGGY	RCCATTTGKYNN	Misc Kulakovskiy et al.(2013) MSGN1_MOUSE.H11MO.0.C	0.859	0.945
MSGN1 M04145_2.00	Homo sapiens	NRMCAWWTGSYN	NRSCAWWTGKYN	SELEX Yin et al.(2017) MSGN1_eDBD_Methyl-HT-SELEX	0.859	0.945
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ogr03919	bHLH	107	161	RRRKASEREKLRMRSLAEALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYISELT

Links
Other bHLH family TFs
Other *Ophisaurus gracilis* TFs