CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

fgenesh1_pm.sca_14_chr10_3_0000034 *(Nectria haematococca)* C2H2 ZF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00096 (zf-C2H2)	IPR007087	fgenesh1_pm.sca_14_chr10_3_0000034	T139059_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FGRRES_01877 M01175_2.00	Fusarium graminearum	NNNRGCTGNN	NNCAGCYNNN	PBM Lambert et al.(2019) pTH10260	0.827	1.000
NCU03699 M01878_2.00	Neurospora crassa	NNVRGCTGDN	NHCAGCYBNN	PBM Weirauch et al.(2014) pTH8956	0.822	0.976
For this family, TFs with SR scores > 0.755* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
fgenesh1_pm.sca_14_chr10_3_0000034	C2H2 ZF	270	291	QRCTWPDCGKTFKDLKAHMLTH
fgenesh1_pm.sca_14_chr10_3_0000034	C2H2 ZF	298	324	KCPIQTCEYHTKGFARKYDKNRHTLTH
fgenesh1_pm.sca_14_chr10_3_0000034	C2H2 ZF	329	359	MVCGFCPGSGSAAEKSFNRADVFKRHLTAVH
fgenesh1_pm.sca_14_chr10_3_0000034	C2H2 ZF	392	411	KCSTCSQTFSNAQDFYEHLD

Links
Other C2H2 ZF family TFs
Other *Nectria haematococca* TFs