CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GSMUA_Achr11G21630_001 *(Musa acuminata)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	GSMUA_Achr11G21630_001	T002303_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB1F M00962_2.00	Arabidopsis thaliana	NRCCGACNN	NNGTCGGYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_thaliana	0.772	0.800
DREB1F M00840_2.00	Arabidopsis thaliana	NRYCGACNN	NNGTCGRYN	PBM Franco-Zorrilla et al.(2014) DDF1	0.772	0.800
DDF1 M00964_2.00	Arabidopsis lyrata	NRYCGACDY	RHGTCGRYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_lyrata	0.772	0.800
DREB1F M06564_2.00	Arabidopsis thaliana	NHNHYGYCGACATNN	NNATGTCGRCRDNDN	Dap-seq OMalley et al.(2016) DDF1_col_a	0.772	0.800
DREB1F M06565_2.00	Arabidopsis thaliana	HNDNNRYCGACAH	DTGTCGRYNNHND	Dap-seq OMalley et al.(2016) DDF1_colamp_a	0.772	0.800
DREB1F M09701_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1F_03	0.772	0.800
DREB1D M06678_2.00	Arabidopsis thaliana	NHBRCCGACRTNN	NNAYGTCGGYVDN	Dap-seq OMalley et al.(2016) CBF4_col_a	0.752	0.880
DREB1D M06679_2.00	Arabidopsis thaliana	HYRCCGACATND	HNATGTCGGYRD	Dap-seq OMalley et al.(2016) CBF4_colamp_a	0.752	0.880
DREB1A M01624_2.00	Arabidopsis thaliana	NRCCGACNNN	NNNGTCGGYN	PBM Weirauch et al.(2014) pTH8163	0.749	0.860
DREB1A M01625_2.00	Arabidopsis thaliana	NNRCCGACNW	WNGTCGGYNN	PBM Weirauch et al.(2014) pTH9718	0.749	0.860
DREB1A M06641_2.00	Arabidopsis thaliana	HNYBRCCGACDWNN	NNWHGTCGGYVRND	Dap-seq OMalley et al.(2016) CBF3_col_a	0.749	0.860
DREB1A M06642_2.00	Arabidopsis thaliana	YBRCCGACATN	NATGTCGGYVR	Dap-seq OMalley et al.(2016) CBF3_colamp_a	0.749	0.860
ddf2 M00965_2.00	Arabidopsis lyrata	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_lyrata	0.744	0.760
DREB1G M01635_2.00	Oryza sativa	NYGCCGACAN	NTGTCGGCRN	PBM Weirauch et al.(2014) pTH8352	0.726	0.820
DREB1G M09707_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1G_01	0.726	0.820
DREB1C M01623_2.00	Arabidopsis thaliana	RCCGACAT	ATGTCGGY	PBM Weirauch et al.(2014) pTH8187	0.717	0.820
DREB1C M06639_2.00	Arabidopsis thaliana	NNNHBRCCGACATNN	NNATGTCGGYVDNNN	Dap-seq OMalley et al.(2016) CBF2_col_a	0.717	0.820
DREB1C M06640_2.00	Arabidopsis thaliana	NYBRCCGACATVN	NBATGTCGGYVRN	Dap-seq OMalley et al.(2016) CBF2_colamp_a	0.717	0.820
DREB1E M09709_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1E_01	0.693	0.840
DREB1E M00963_2.00	Arabidopsis thaliana	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_thaliana	0.678	0.720
DREB1E M06589_2.00	Arabidopsis thaliana	NNNYYGYCGACATVD	HBATGTCGRCRRNNN	Dap-seq OMalley et al.(2016) DDF2_col_a	0.678	0.720
DREB1E M09702_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1E_03	0.678	0.720
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr11P21630_001	AP2	48	99	PVYKGVRRRNGDKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAAMALRGR

Links
Other AP2 family TFs
Other *Musa acuminata* TFs

185 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
MTR_2g090080	Medicago truncatula	MTR_2g090080	N
Gorai.008G152400	Gossypium raimondii	Gorai.008G152400	N
Carubv10005638m.g	Capsella rubella	Carubv10005638m.g	N
Cagra.20132s0010	Capsella grandiflora	Cagra.20132s0010	N
Cagra.1225s0078	Capsella grandiflora	Cagra.1225s0078	N
Bostr.7867s0654	Boechera stricta	Bostr.7867s0654	N
cassava18740.valid.m1	Manihot esculenta	cassava18740.valid.m1	N
VIT_12s0059g01980	Vitis vinifera	VIT_12s0059g01980	N
Solyc07g054450.2	Solanum lycopersicum	Solyc07g054450.2	N
PGSC0003DMG400018322	Solanum tuberosum	PGSC0003DMG400018322	N
ULT1	Arabidopsis thaliana	AT4G28190	N
GLYMA12G11800	Glycine max	GLYMA12G11800	N
GLYMA06G45180	Glycine max	GLYMA06G45180	N
ULT1	Arabidopsis lyrata	fgenesh2_kg.7__1389__AT4G28190.1	N
Bra036504	Brassica rapa	Bra036504	N
Bra026276	Brassica rapa	Bra026276	N
Bra024219	Brassica rapa	Bra024219	N
Bo7g111950	Brassica oleracea	Bo7g111950	N
Bo1g051270	Brassica oleracea	Bo1g051270	N
Bo00902s070	Brassica oleracea	Bo00902s070	N

GSMUA_Achr11G21630_001 (Musa acuminata) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

185 Related TFs

GSMUA_Achr11G21630_001 **(Musa acuminata)
AP2**