CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc10g006510.2 *(Solanum lycopersicum)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	Solyc10g006510.2	T045129_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BHLH34 M01704_2.00	Arabidopsis thaliana	VCACGYGH	DCRCGTGB	PBM Weirauch et al.(2014) pTH7212	0.883	0.731
BHLH34 M06734_2.00	Arabidopsis thaliana	NNNHNNDNNNNVCACGTGHCN	NGDCACGTGBNNNNHNNDNNN	Dap-seq OMalley et al.(2016) bHLH34_colamp_a	0.883	0.731
BHLH34 M06735_2.00	Arabidopsis thaliana	RWRNNNNNCACGTGBNNNNNNNN	NNNNNNNNVCACGTGNNNNNYWY	Dap-seq OMalley et al.(2016) bHLH34_col	0.883	0.731
BHLH104 M01706_2.00	Arabidopsis thaliana	GGCACGTGCC	GGCACGTGCC	PBM Weirauch et al.(2014) pTH7365	0.842	0.654
BHLH104 M06737_2.00	Arabidopsis thaliana	GVCACGTGBMDDBHNSDNBH	DVNHSNDVHHKVCACGTGBC	Dap-seq OMalley et al.(2016) bHLH104_col_b	0.842	0.654
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc10g006510.2.1	bHLH	73	124	SSSSKACREKLRREKLNEKFMELAVLLEPSRPPKTDKSAILVDAVRVVTQLR

Links
Other bHLH family TFs
Other *Solanum lycopersicum* TFs